PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_19409_BGI-A2_v1.0
Common NameF383_28275
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family B3
Protein Properties Length: 345aa    MW: 39628.2 Da    PI: 9.5867
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_19409_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3505.3e-16595197
                                EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                          B3  1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85
                                ff +l+ s +l+++ l++p +f++++  +   s+   l+ ++g +W+v +  +k ++++++++GW+eF +   +++g ++vF+++
  Cotton_A_19409_BGI-A2_v1.0  5 FFHKLILSTTLQEKKLRIPDNFVKKFRDE--LSVAAALTVPDGHVWRVGI--KKVDNKVWFQEGWQEFLERYYIRVGYVLVFRYE 85
                                788999999**************999755..999****************..********************************* PP

                                SSSEE..EEEEE CS
                          B3 86 grsefelvvkvf 97
                                g+s f   v++f
  Cotton_A_19409_BGI-A2_v1.0 86 GNSAF--SVSIF 95
                                *9999..88887 PP

2B365.57.7e-21243333498
                                 E-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                          B3   4 vltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                                 vl ps+  + ++++lp  fae+h +g++ +   ++l+ ++gr+W+v++ y++++    +++GW eF  +n+L egD++vF+l 
  Cotton_A_19409_BGI-A2_v1.0 243 VLRPSYLYRGCIMYLPSCFAEKHlSGVS-G--SIKLQLPDGRQWSVRCLYKGGK--AKFSQGWYEFTLENNLGEGDVCVFELL 320
                                 78899******************86663.3..59999***********555555..6699**********************9 PP

                                 SSSEE..EEEEE- CS
                          B3  86 grsefelvvkvfr 98 
                                 +++ef l+v+vfr
  Cotton_A_19409_BGI-A2_v1.0 321 RSREFVLKVTVFR 333
                                 99*********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.2E-21396IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.61E-21396IPR015300DNA-binding pseudobarrel domain
CDDcd100171.32E-17596No hitNo description
PfamPF023627.2E-13595IPR003340B3 DNA binding domain
PROSITE profilePS5086313.521598IPR003340B3 DNA binding domain
SMARTSM010191.2E-12698IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.9E-25232333IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.57E-24233333IPR015300DNA-binding pseudobarrel domain
CDDcd100172.74E-23238333No hitNo description
PROSITE profilePS5086313.958240335IPR003340B3 DNA binding domain
SMARTSM010197.1E-23240335IPR003340B3 DNA binding domain
PfamPF023621.2E-18243333IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009909Biological Processregulation of flower development
GO:0010048Biological Processvernalization response
GO:0005654Cellular Componentnucleoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MPRPFFHKLI LSTTLQEKKL RIPDNFVKKF RDELSVAAAL TVPDGHVWRV GIKKVDNKVW  60
FQEGWQEFLE RYYIRVGYVL VFRYEGNSAF SVSIFNLYNS EINYQTNALV GTQYNHGKQY  120
PFEQLEDDEC ISPALQNLFG GSKLNNCINW GGDANLQTSK GVNNQPIRGS GAMKPEPKKR  180
GRKRKFDPNV QDSSTGREDD VDMRFRCYES ASARKRTVTA EERERAINAA KAFEPTNPFC  240
RVVLRPSYLY RGCIMYLPSC FAEKHLSGVS GSIKLQLPDG RQWSVRCLYK GGKAKFSQGW  300
YEFTLENNLG EGDVCVFELL RSREFVLKVT VFRVMESGGL MHRSQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A4e-7420833617144B3 domain-containing transcription factor VRN
4i1k_B4e-7420833617144B3 domain-containing transcription factor VRN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012462595.10.0PREDICTED: B3 domain-containing transcription factor VRN1-like isoform X2
SwissprotQ8L3W11e-156VRN1_ARATH; B3 domain-containing transcription factor VRN1
TrEMBLA0A0B0MUL50.0A0A0B0MUL5_G
STRINGPOPTR_0009s11170.11e-162(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112428103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-152B3 family protein